Class b: All beta proteins [48724] (126 folds) |
Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family) |
Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins) |
Protein Cyclophilin (eukaryotic) [50893] (8 species) |
Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (42 PDB entries) |
Domain d1cwma_: 1cwm A: [27433] complexed with aba, iml, tmb |
PDB Entry: 1cwm (more details), 2 Å
SCOP Domain Sequences for d1cwma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cwma_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A} mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
Timeline for d1cwma_: