SCOP 1.75: Domain d1cwha_: 1cwh A:

Lineage for d1cwha_ (1cwh A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (4 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (12 proteins)

6. Protein Cyclophilin (eukaryotic) [50893] (13 species)

7. Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (48 PDB entries)
   Uniprot P05092

8. Domain d1cwha_: 1cwh A: [27430]
   complexed with aba, dse

Details for d1cwha_

PDB Entry: 1cwh, 1.86 Å

PDB Description: human cyclophilin a complexed with 3-d-ser cyclosporin

PDB Compounds: (A:) cyclophilin a

SCOP Domain Sequences for d1cwha_:

Sequence; same for both SEQRES and ATOM records:

>d1cwha_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

Timeline for d1cwha_:

• d1cwha_ first appeared (with stable ids) in SCOP 1.55
  
• d1cwha_ appears in SCOP 1.73
  
• d1cwha_ appears in SCOPe 2.01
  
• d1cwha_ appears in the current release, SCOPe 2.08