SCOPe 2.06: Domain d4udub1: 4udu B:3-114

Lineage for d4udub1 (4udu B:3-114)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d4udub1: 4udu B:3-114 [274295]
   Other proteins in same PDB: d4udua2, d4uduc1, d4uduc2
   automated match to d3q5ya1
   complexed with na, zn

Details for d4udub1

PDB Entry: 4udu, 2.5 Å

PDB Description: crystal structure of staphylococcal enterotoxin e in complex with a t cell receptor

PDB Compounds: (B:) protein trbv7-9, T-cell receptor beta-2 chain c region

SCOPe Domain Sequences for d4udub1:

Sequence; same for both SEQRES and ATOM records:

>d4udub1 b.1.1.0 (B:3-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tgvsqnprhkitkrgqnvtfrcdpisehnrlywyrqtlgqgpefltyfqneaqleksrll
sdrfsaerpkgsfstleiqrteqgdsamylcasslggyeqyfgpgtrltvte

Timeline for d4udub1:

• d4udub1 first appeared in SCOPe 2.05
  
• d4udub1 appears in SCOPe 2.07
  
• d4udub1 appears in the current release, SCOPe 2.08