SCOPe 2.08: Domain d4ua6b_: 4ua6 B:

Lineage for d4ua6b_ (4ua6 B:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein automated matches [190161] (29 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187306] (111 PDB entries)

8. Domain d4ua6b_: 4ua6 B: [274287]
   automated match to d1ylta_
   complexed with k, po4

Details for d4ua6b_

PDB Entry: 4ua6, 0.79 Å

PDB Description: ctx-m-14 class a beta-lactamase apo crystal structure at 0.79 angstrom resolution

PDB Compounds: (B:) beta-lactamase CTX-M-14

SCOPe Domain Sequences for d4ua6b_:

Sequence; same for both SEQRES and ATOM records:

>d4ua6b_ e.3.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
avqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqsetqk
qllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpggv
tafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraqlv
twlkgnttgaasiraglptswtvgdktgsgdygttndiaviwpqgraplvlvtyftqpqq
naesrrdvlasaariiaegl

Timeline for d4ua6b_:

• d4ua6b_ first appeared in SCOPe 2.05
  
• d4ua6b_ appears in SCOPe 2.07