Lineage for d4ua9b_ (4ua9 B:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244155Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2244156Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2244157Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2244965Protein automated matches [190161] (23 species)
    not a true protein
  7. 2245030Species Escherichia coli [TaxId:562] [187306] (66 PDB entries)
  8. 2245037Domain d4ua9b_: 4ua9 B: [274281]
    automated match to d1ylta_
    complexed with cb4, po4

Details for d4ua9b_

PDB Entry: 4ua9 (more details), 0.84 Å

PDB Description: ctx-m-14 class a beta-lactamase in complex with a boronic acid acylation transition state analog at sub-angstrom resolution
PDB Compounds: (B:) beta-lactamase CTX-M-14

SCOPe Domain Sequences for d4ua9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ua9b_ e.3.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
avqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqsetqk
qllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpggv
tafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraqlv
twlkgnttgaasiraglptswtvgdktgsgdygttndiaviwpqgraplvlvtyftqpqq
naesrrdvlasaariiaegl

SCOPe Domain Coordinates for d4ua9b_:

Click to download the PDB-style file with coordinates for d4ua9b_.
(The format of our PDB-style files is described here.)

Timeline for d4ua9b_: