SCOPe 2.07: Domain d4r90l2: 4r90 L:111-212

Lineage for d4r90l2 (4r90 L:111-212)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Llama glama [TaxId:9844] [271450] (2 PDB entries)

8. Domain d4r90l2: 4r90 L:111-212 [274264]
   Other proteins in same PDB: d4r90l1
   automated match to d3n9gl2
   complexed with ca, gol

Details for d4r90l2

PDB Entry: 4r90, 1.75 Å

PDB Description: anti cd70 llama glama fab 27b3

PDB Compounds: (L:) Anti CD70 Llama glama Fab 27B3 Light chain

SCOPe Domain Sequences for d4r90l2:

Sequence; same for both SEQRES and ATOM records:

>d4r90l2 b.1.1.2 (L:111-212) automated matches {Llama glama [TaxId: 9844]}
sqpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpsk
qsnnkyaassylsltpeqwkshrsyscqvthegstvektvap

Timeline for d4r90l2:

• d4r90l2 first appeared in SCOPe 2.05
  
• d4r90l2 appears in SCOPe 2.06
  
• d4r90l2 appears in the current release, SCOPe 2.08