SCOPe 2.06: Domain d4qnkc2: 4qnk C:96-193

Lineage for d4qnkc2 (4qnk C:96-193)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (2 proteins)
   duplication; there are two structural repeats of this fold

6. Protein automated matches [254526] (1 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255158] (10 PDB entries)

8. Domain d4qnkc2: 4qnk C:96-193 [274258]
   Other proteins in same PDB: d4qnka1, d4qnkb1, d4qnkc1, d4qnkd1, d4qnke1, d4qnkf1, d4qnkg1, d4qnkh1
   automated match to d4mu3a2
   complexed with edo, mn, na, po4

Details for d4qnkc2

PDB Entry: 4qnk, 1.75 Å

PDB Description: the structure of wt a. thaliana igpd2 in complex with mn2+ and phosphate

PDB Compounds: (C:) Imidazoleglycerol-phosphate dehydratase 2, chloroplastic

SCOPe Domain Sequences for d4qnkc2:

Sequence; same for both SEQRES and ATOM records:

>d4qnkc2 d.14.1.9 (C:96-193) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ginrfgdftapldealihvsldlsgrpylgynleiptqrvgtydtqlvehffqslvntsg
mtlhirqlagknshhiieatfkafaralrqatesdprr

Timeline for d4qnkc2:

• d4qnkc2 first appeared in SCOPe 2.05
  
• d4qnkc2 appears in SCOPe 2.07
  
• d4qnkc2 appears in the current release, SCOPe 2.08