Lineage for d4qnke2 (4qnk E:96-193)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930730Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (2 proteins)
    duplication; there are two structural repeats of this fold
  6. 2930753Protein automated matches [254526] (2 species)
    not a true protein
  7. 2930779Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255158] (11 PDB entries)
  8. 2930792Domain d4qnke2: 4qnk E:96-193 [274256]
    Other proteins in same PDB: d4qnka1, d4qnkb1, d4qnkc1, d4qnkd1, d4qnke1, d4qnkf1, d4qnkg1, d4qnkh1
    automated match to d4mu3a2
    complexed with edo, mn, na, po4

Details for d4qnke2

PDB Entry: 4qnk (more details), 1.75 Å

PDB Description: the structure of wt a. thaliana igpd2 in complex with mn2+ and phosphate
PDB Compounds: (E:) Imidazoleglycerol-phosphate dehydratase 2, chloroplastic

SCOPe Domain Sequences for d4qnke2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qnke2 d.14.1.9 (E:96-193) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ginrfgdftapldealihvsldlsgrpylgynleiptqrvgtydtqlvehffqslvntsg
mtlhirqlagknshhiieatfkafaralrqatesdprr

SCOPe Domain Coordinates for d4qnke2:

Click to download the PDB-style file with coordinates for d4qnke2.
(The format of our PDB-style files is described here.)

Timeline for d4qnke2: