Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (2 proteins) duplication; there are two structural repeats of this fold |
Protein automated matches [254526] (1 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255158] (7 PDB entries) |
Domain d4qnkg2: 4qnk G:96-193 [274244] Other proteins in same PDB: d4qnka1, d4qnkb1, d4qnkc1, d4qnkd1, d4qnke1, d4qnkf1, d4qnkg1, d4qnkh1 automated match to d4mu3a2 complexed with edo, mn, na, po4 |
PDB Entry: 4qnk (more details), 1.75 Å
SCOPe Domain Sequences for d4qnkg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qnkg2 d.14.1.9 (G:96-193) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} ginrfgdftapldealihvsldlsgrpylgynleiptqrvgtydtqlvehffqslvntsg mtlhirqlagknshhiieatfkafaralrqatesdprr
Timeline for d4qnkg2: