![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (14 species) not a true protein |
![]() | Species Mus musculus [TaxId:10090] [272441] (35 PDB entries) |
![]() | Domain d4odub2: 4odu B:108-212 [274238] Other proteins in same PDB: d4odub1, d4odul1 automated match to d2v7ha2 complexed with so4 |
PDB Entry: 4odu (more details), 2.29 Å
SCOPe Domain Sequences for d4odub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4odub2 b.1.1.2 (B:108-212) automated matches {Mus musculus [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrn
Timeline for d4odub2: