SCOPe 2.05: Domain d4odwb1: 4odw B:1-107

Lineage for d4odwb1 (4odw B:1-107)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [272437] (43 PDB entries)

8. Domain d4odwb1: 4odw B:1-107 [274233]
   Other proteins in same PDB: d4odwb2, d4odwl2
   automated match to d1h3pl1
   complexed with trs

Details for d4odwb1

PDB Entry: 4odw, 2.72 Å

PDB Description: unliganded fab structure of lipid a-specific antibody a6

PDB Compounds: (B:) A6 Fab (IgG2b kappa) light chain

SCOPe Domain Sequences for d4odwb1:

Sequence; same for both SEQRES and ATOM records:

>d4odwb1 b.1.1.0 (B:1-107) automated matches {Mus musculus [TaxId: 10090]}
divltqstsslsaslgdrvtitcrasqdirnylswyqqrpdgtvklliyytsklhsgvps
rfsgsgsgtdysltitnleqediatyfcqqgktlplytfgggtkleik

Timeline for d4odwb1:

• d4odwb1 is new in SCOPe 2.05-stable
  
• d4odwb1 appears in SCOPe 2.06
  
• d4odwb1 appears in the current release, SCOPe 2.08