SCOPe 2.06: Domain d4pmda1: 4pmd A:10-337

Lineage for d4pmda1 (4pmd A:10-337)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (90 species)
   not a true protein

7. Species Caldicellulosiruptor bescii [TaxId:521460] [256973] (6 PDB entries)

8. Domain d4pmda1: 4pmd A:10-337 [274230]
   Other proteins in same PDB: d4pmda2
   automated match to d4l4oa_
   complexed with bxp; mutant

Details for d4pmda1

PDB Entry: 4pmd, 1.7 Å

PDB Description: crystal structure of cbxyn10b from caldicellulosiruptor bescii and its mutant(e139a) in complex with hydrolyzed xylotetraose

PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d4pmda1:

Sequence; same for both SEQRES and ATOM records:

>d4pmda1 c.1.8.0 (A:10-337) automated matches {Caldicellulosiruptor bescii [TaxId: 521460]}
tvsltekykeffkigaavtvkdfegihgriltkhfnsltpendmkferihpkedfynfea
tdkikdfalkhnmqlrghtlvwhnqtpewvfrdndkeapkelvierlrehiktictryrd
vvyswdvvnaavedktdvllrdskwrriigddyikiafeiakkytgngklfyndynnemp
yklektykvlkslleegtpidgvgiqahwniwdknlidnlkraietyaslgleiqiteld
isvfefedrrtdllepteemvelqakvyedvfrvfreyrdvitsvtlwgisdrhtwkdnf
pvigrkdwpllfdidgkpkkaffriidf

Timeline for d4pmda1:

• d4pmda1 first appeared in SCOPe 2.05, called d4pmda_
  
• d4pmda1 appears in SCOPe 2.07
  
• d4pmda1 appears in the current release, SCOPe 2.08