Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (90 species) not a true protein |
Species Caldicellulosiruptor bescii [TaxId:521460] [256973] (6 PDB entries) |
Domain d4pmda1: 4pmd A:10-337 [274230] Other proteins in same PDB: d4pmda2 automated match to d4l4oa_ complexed with bxp; mutant |
PDB Entry: 4pmd (more details), 1.7 Å
SCOPe Domain Sequences for d4pmda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pmda1 c.1.8.0 (A:10-337) automated matches {Caldicellulosiruptor bescii [TaxId: 521460]} tvsltekykeffkigaavtvkdfegihgriltkhfnsltpendmkferihpkedfynfea tdkikdfalkhnmqlrghtlvwhnqtpewvfrdndkeapkelvierlrehiktictryrd vvyswdvvnaavedktdvllrdskwrriigddyikiafeiakkytgngklfyndynnemp yklektykvlkslleegtpidgvgiqahwniwdknlidnlkraietyaslgleiqiteld isvfefedrrtdllepteemvelqakvyedvfrvfreyrdvitsvtlwgisdrhtwkdnf pvigrkdwpllfdidgkpkkaffriidf
Timeline for d4pmda1: