Lineage for d4pmda_ (4pmd A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1820295Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 1820296Protein automated matches [190075] (72 species)
    not a true protein
  7. 1820359Species Caldicellulosiruptor bescii [TaxId:521460] [256973] (3 PDB entries)
  8. 1820360Domain d4pmda_: 4pmd A: [274230]
    automated match to d4l4oa_
    complexed with bxp; mutant

Details for d4pmda_

PDB Entry: 4pmd (more details), 1.7 Å

PDB Description: crystal structure of cbxyn10b from caldicellulosiruptor bescii and its mutant(e139a) in complex with hydrolyzed xylotetraose
PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d4pmda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pmda_ c.1.8.0 (A:) automated matches {Caldicellulosiruptor bescii [TaxId: 521460]}
tvsltekykeffkigaavtvkdfegihgriltkhfnsltpendmkferihpkedfynfea
tdkikdfalkhnmqlrghtlvwhnqtpewvfrdndkeapkelvierlrehiktictryrd
vvyswdvvnaavedktdvllrdskwrriigddyikiafeiakkytgngklfyndynnemp
yklektykvlkslleegtpidgvgiqahwniwdknlidnlkraietyaslgleiqiteld
isvfefedrrtdllepteemvelqakvyedvfrvfreyrdvitsvtlwgisdrhtwkdnf
pvigrkdwpllfdidgkpkkaffriidfl

SCOPe Domain Coordinates for d4pmda_:

Click to download the PDB-style file with coordinates for d4pmda_.
(The format of our PDB-style files is described here.)

Timeline for d4pmda_:

  • d4pmda_ appears in periodic updates to SCOPe 2.05 starting on 2015-06-24
  • d4pmda_ is called d4pmda1 in SCOPe 2.06
  • d4pmda_ appears in the current release, SCOPe 2.07, called d4pmda1