Lineage for d2cyha_ (2cyh A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 301509Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 301510Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family) (S)
  5. 301511Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)
  6. 301517Protein Cyclophilin (eukaryotic) [50893] (8 species)
  7. 301526Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (42 PDB entries)
  8. 301528Domain d2cyha_: 2cyh A: [27421]

Details for d2cyha_

PDB Entry: 2cyh (more details), 1.64 Å

PDB Description: cyclophilin a complexed with dipeptide ala-pro

SCOP Domain Sequences for d2cyha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cyha_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOP Domain Coordinates for d2cyha_:

Click to download the PDB-style file with coordinates for d2cyha_.
(The format of our PDB-style files is described here.)

Timeline for d2cyha_: