SCOPe 2.08: Domain d5bwmb_: 5bwm B:

Lineage for d5bwmb_ (5bwm B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.0: automated matches [191650] (1 protein)
   not a true family

6. Protein automated matches [191197] (13 species)
   not a true protein

7. Species Bacillus cereus [TaxId:1396] [274205] (3 PDB entries)

8. Domain d5bwmb_: 5bwm B: [274206]
   Other proteins in same PDB: d5bwma_
   automated match to d3bw8a_
   complexed with edo, gdp, mg, nai

Details for d5bwmb_

PDB Entry: 5bwm, 2.5 Å

PDB Description: the complex structure of c3cer exoenzyme and gdp bound rhoa (nadh- bound state)

PDB Compounds: (B:) ADP-ribosyltransferase

SCOPe Domain Sequences for d5bwmb_:

Sequence; same for both SEQRES and ATOM records:

>d5bwmb_ d.166.1.0 (B:) automated matches {Bacillus cereus [TaxId: 1396]}
kyklctnkeeadawgkkqfnkwskeeksairdytknarpyneflrmhagkldsdptmkkk
iesldkalnrkeakvndnikvyrgddawifgkeydnsiikngkvdrekfkeiqkkfqgkt
ttefgyistsilidagyaktrpvmtefkvgsgthgaymnsddltaypgqyelllprntvy
kiekiyiaidnntqkeqikveatik

Timeline for d5bwmb_:

• d5bwmb_ first appeared in SCOPe 2.05
  
• d5bwmb_ appears in SCOPe 2.07