Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
Protein automated matches [190032] (18 species) not a true protein |
Species Toxoplasma gondii [TaxId:508771] [230191] (2 PDB entries) |
Domain d5bxih_: 5bxi H: [274192] Other proteins in same PDB: d5bxid2, d5bxig2 automated match to d4o0nb_ complexed with bct, peg |
PDB Entry: 5bxi (more details), 1.7 Å
SCOPe Domain Sequences for d5bxih_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bxih_ d.58.6.1 (H:) automated matches {Toxoplasma gondii [TaxId: 508771]} akqqertyimvkpdgvqrglvsevirrfeqrgyklvalkmkspdatlleehyadlkgkpf fpglisymtsgpvvcmvwegtdvvkqgrrmlgetrplesnpgtlrgdfcidvgrnivhgs dsvesankeislwftpeeicewtsaqhkwvye
Timeline for d5bxih_: