SCOPe 2.08: Domain d5bw2b_: 5bw2 B:

Lineage for d5bw2b_ (5bw2 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (5 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries)

8. Domain d5bw2b_: 5bw2 B: [274186]
   Other proteins in same PDB: d5bw2a2, d5bw2c2, d5bw2e2
   automated match to d3sioc_
   complexed with 4vu

Details for d5bw2b_

PDB Entry: 5bw2, 2.27 Å

PDB Description: x-ray crystal structure of aplysia californica acetylcholine binding protein (ac-achbp) y55w in complex with 2-pyridin-3-yl-1-aza- bicyclo[2.2.2]octane; 2-(3-pyridyl)quinuclidine; 2-pq (ti-4699)

PDB Compounds: (B:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d5bw2b_:

Sequence, based on SEQRES records:

>d5bw2b_ b.96.1.0 (B:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
sqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrwk
lnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaq
rlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatq
trqvqhysccpepyidvnlvvkfrerra

Sequence, based on observed residues (ATOM records):

>d5bw2b_ b.96.1.0 (B:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
sqanlmrlksdlfypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrwklnslm
wdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqrlsfm
cdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqtrqvq
hysccpepyidvnlvvkfrerra

Timeline for d5bw2b_:

• d5bw2b_ first appeared in SCOPe 2.05
  
• d5bw2b_ appears in SCOPe 2.07