SCOPe 2.08: Domain d5brxf1: 5brx F:1-207

Lineage for d5brxf1 (5brx F:1-207)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (5 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries)

8. Domain d5brxf1: 5brx F:1-207 [274180]
   Other proteins in same PDB: d5brxa2, d5brxb2, d5brxc2, d5brxd2, d5brxe2, d5brxf2, d5brxg2, d5brxh2, d5brxi2, d5brxj2
   automated match to d3sioc_
   complexed with pg4, so4, ti4

Details for d5brxf1

PDB Entry: 5brx, 2.05 Å

PDB Description: x-ray crystal structure of aplysia californica (ac-achbp) in complex with 2-pyridyl azatricyclo[3.3.1.13,7]decane; 2-pyridylazaadamantane; 2-aza (ti-8480)

PDB Compounds: (F:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d5brxf1:

Sequence, based on SEQRES records:

>d5brxf1 b.96.1.0 (F:1-207) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfrer

Sequence, based on observed residues (ATOM records):

>d5brxf1 b.96.1.0 (F:1-207) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrwkln
slmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqrl
sfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqtr
qvqhysccpepyidvnlvvkfrer

Timeline for d5brxf1:

• d5brxf1 first appeared in SCOPe 2.05, called d5brxf_
  
• d5brxf1 appears in SCOPe 2.07