![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
![]() | Superfamily b.61.3: D-aminopeptidase, middle and C-terminal domains [50886] (1 family) ![]() |
![]() | Family b.61.3.1: D-aminopeptidase, middle and C-terminal domains [50887] (1 protein) |
![]() | Protein D-aminopeptidase, middle and C-terminal domains [50888] (1 species) duplication: both domains have this barrel fold |
![]() | Species Ochrobactrum anthropi [TaxId:529] [50889] (1 PDB entry) |
![]() | Domain d1ei5a1: 1ei5 A:336-417 [27418] Other proteins in same PDB: d1ei5a3 |
PDB Entry: 1ei5 (more details), 1.9 Å
SCOPe Domain Sequences for d1ei5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ei5a1 b.61.3.1 (A:336-417) D-aminopeptidase, middle and C-terminal domains {Ochrobactrum anthropi [TaxId: 529]} evsrveadsawfgswlddetglvlsledaghgrmkarfgtspemmdvvsanearsavtti rrdgetielvrasenlrlsmkr
Timeline for d1ei5a1: