SCOP 1.63: Domain d1smpi_: 1smp I:

Lineage for d1smpi_ (1smp I:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.61: Streptavidin-like [50875] (5 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.2: Metalloprotease inhibitor [50882] (1 family)

5. Family b.61.2.1: Metalloprotease inhibitor [50883] (1 protein)

6. Protein Metalloprotease inhibitor [50884] (2 species)

7. Species Erwinia chrysanthemi [TaxId:556] [50885] (1 PDB entry)

8. Domain d1smpi_: 1smp I: [27417]
   Other proteins in same PDB: d1smpa1, d1smpa2
   complexed with ca, zn

Details for d1smpi_

PDB Entry: 1smp, 2.3 Å

PDB Description: crystal structure of a complex between serratia marcescens metallo-protease and an inhibitor from erwinia chrysanthemi

SCOP Domain Sequences for d1smpi_:

Sequence; same for both SEQRES and ATOM records:

>d1smpi_ b.61.2.1 (I:) Metalloprotease inhibitor {Erwinia chrysanthemi}
sslrlpsaaelsgqwvlsgaeqhcdirlntdvldgttwklagdtaclqkllpeapvgwrp
tpdgltltqadgsavaffsrnrdryehklvdgsvrtlkkk

Timeline for d1smpi_:

• d1smpi_ first appeared (with stable ids) in SCOP 1.55
  
• d1smpi_ appears in SCOP 1.61
  
• d1smpi_ appears in SCOP 1.65
  
• d1smpi_ appears in the current release, SCOPe 2.08