Class b: All beta proteins [48724] (180 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins) automatically mapped to Pfam PF02931 |
Protein automated matches [190922] (2 species) not a true protein |
Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (38 PDB entries) |
Domain d5bp0i1: 5bp0 I:1-204 [274167] Other proteins in same PDB: d5bp0a2, d5bp0b2, d5bp0c2, d5bp0d2, d5bp0e2, d5bp0f2, d5bp0g2, d5bp0h2, d5bp0i2, d5bp0j2 automated match to d4alxa_ complexed with fn1, nag, po4 |
PDB Entry: 5bp0 (more details), 2.4 Å
SCOPe Domain Sequences for d5bp0i1:
Sequence, based on SEQRES records: (download)
>d5bp0i1 b.96.1.1 (I:1-204) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk nsvtysccpeayedvevslnfrkk
>d5bp0i1 b.96.1.1 (I:1-204) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr fscdvsgvdtesgatcrikigswthhsreisvdpsddseyfsqysrfeildvtqkknsvt ysccpeayedvevslnfrkk
Timeline for d5bp0i1: