Lineage for d5bp0i1 (5bp0 I:1-204)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2819475Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2819476Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2819477Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. 2819576Protein automated matches [190922] (2 species)
    not a true protein
  7. 2819577Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (38 PDB entries)
  8. 2819730Domain d5bp0i1: 5bp0 I:1-204 [274167]
    Other proteins in same PDB: d5bp0a2, d5bp0b2, d5bp0c2, d5bp0d2, d5bp0e2, d5bp0f2, d5bp0g2, d5bp0h2, d5bp0i2, d5bp0j2
    automated match to d4alxa_
    complexed with fn1, nag, po4

Details for d5bp0i1

PDB Entry: 5bp0 (more details), 2.4 Å

PDB Description: x-ray crystal structure of lymnaea stagnalis acetylcholine binding protein (ls-achbp) in complex with 5-fluoronicotine (ti-4650)
PDB Compounds: (I:) acetylcholine-binding protein

SCOPe Domain Sequences for d5bp0i1:

Sequence, based on SEQRES records: (download)

>d5bp0i1 b.96.1.1 (I:1-204) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkk

Sequence, based on observed residues (ATOM records): (download)

>d5bp0i1 b.96.1.1 (I:1-204) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpsddseyfsqysrfeildvtqkknsvt
ysccpeayedvevslnfrkk

SCOPe Domain Coordinates for d5bp0i1:

Click to download the PDB-style file with coordinates for d5bp0i1.
(The format of our PDB-style files is described here.)

Timeline for d5bp0i1: