Lineage for d4zv9b_ (4zv9 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1871035Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 1871036Protein automated matches [190543] (71 species)
    not a true protein
  7. 1871165Species Escherichia coli [TaxId:83334] [274143] (1 PDB entry)
  8. 1871167Domain d4zv9b_: 4zv9 B: [274145]
    automated match to d4u2ca_
    complexed with gol, peg, pge, po4

Details for d4zv9b_

PDB Entry: 4zv9 (more details), 2 Å

PDB Description: 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai
PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d4zv9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zv9b_ c.69.1.0 (B:) automated matches {Escherichia coli [TaxId: 83334]}
snaqveftdpeifaeyitypspnghgevrgylvkpakmsgktpavvvvhenrglnpyied
varrvakagyialapdglnsvggypgnddkgrelqqqvdptklmndffaaiefmqrypqa
tgkvgitgfcygggvsnaaavaypelacavpfygrqaptadvakieaplllhfaeldtri
negwpayeaalkannkvyeayiypgvnhgfhndstprydksaadlawqrtlkwfdkyl

SCOPe Domain Coordinates for d4zv9b_:

Click to download the PDB-style file with coordinates for d4zv9b_.
(The format of our PDB-style files is described here.)

Timeline for d4zv9b_: