SCOPe 2.05: Domain d4zv9d_: 4zv9 D:

Lineage for d4zv9d_ (4zv9 D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (71 species)
   not a true protein

7. Species Escherichia coli [TaxId:83334] [274143] (1 PDB entry)

8. Domain d4zv9d_: 4zv9 D: [274144]
   automated match to d4u2ca_
   complexed with gol, peg, pge, po4

Details for d4zv9d_

PDB Entry: 4zv9, 2 Å

PDB Description: 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai

PDB Compounds: (D:) Uncharacterized protein

SCOPe Domain Sequences for d4zv9d_:

Sequence; same for both SEQRES and ATOM records:

>d4zv9d_ c.69.1.0 (D:) automated matches {Escherichia coli [TaxId: 83334]}
snaqveftdpeifaeyitypspnghgevrgylvkpakmsgktpavvvvhenrglnpyied
varrvakagyialapdglnsvggypgnddkgrelqqqvdptklmndffaaiefmqrypqa
tgkvgitgfcygggvsnaaavaypelacavpfygrqaptadvakieaplllhfaeldtri
negwpayeaalkannkvyeayiypgvnhgfhndstprydksaadlawqrtlkwfdkyl

Timeline for d4zv9d_:

• d4zv9d_ is new in SCOPe 2.05-stable
  
• d4zv9d_ is called d4zv9d1 in SCOPe 2.06
  
• d4zv9d_ appears in the current release, SCOPe 2.08, called d4zv9d1