![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
![]() | Protein automated matches [190233] (22 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187090] (78 PDB entries) |
![]() | Domain d4zrib1: 4zri B:21-103 [274137] Other proteins in same PDB: d4zria2, d4zria3, d4zrib2, d4zrib3 automated match to d1h4ra3 |
PDB Entry: 4zri (more details), 2.7 Å
SCOPe Domain Sequences for d4zrib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zrib1 d.15.1.0 (B:21-103) automated matches {Human (Homo sapiens) [TaxId: 9606]} tftvrivtmdaemefncemkwkgkdlfdlvcrtlglretwffglqytikdtvawlkmdkk vldhdvskeepvtfhflakfype
Timeline for d4zrib1: