Class b: All beta proteins [48724] (177 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
Protein automated matches [190052] (6 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [232271] (5 PDB entries) |
Domain d4zrka3: 4zrk A:215-311 [274132] Other proteins in same PDB: d4zrka1, d4zrka2, d4zrkb1, d4zrkb2, d4zrkc1, d4zrkc2, d4zrkd1, d4zrkd2 automated match to d1h4ra2 |
PDB Entry: 4zrk (more details), 2.32 Å
SCOPe Domain Sequences for d4zrka3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zrka3 b.55.1.0 (A:215-311) automated matches {Mouse (Mus musculus) [TaxId: 10090]} emygvnyftirnkkgtelllgvdalglhiydpenrltpkisfpwneirnisysdkeftik pldkkidvfkfnssklrvnklilqlcignhdlfmrrr
Timeline for d4zrka3: