Lineage for d4zrka3 (4zrk A:215-311)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2070980Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2070981Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2071584Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2071585Protein automated matches [190052] (6 species)
    not a true protein
  7. 2071710Species Mouse (Mus musculus) [TaxId:10090] [232271] (5 PDB entries)
  8. 2071719Domain d4zrka3: 4zrk A:215-311 [274132]
    Other proteins in same PDB: d4zrka1, d4zrka2, d4zrkb1, d4zrkb2, d4zrkc1, d4zrkc2, d4zrkd1, d4zrkd2
    automated match to d1h4ra2

Details for d4zrka3

PDB Entry: 4zrk (more details), 2.32 Å

PDB Description: merlin-ferm and lats1 complex
PDB Compounds: (A:) merlin

SCOPe Domain Sequences for d4zrka3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zrka3 b.55.1.0 (A:215-311) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
emygvnyftirnkkgtelllgvdalglhiydpenrltpkisfpwneirnisysdkeftik
pldkkidvfkfnssklrvnklilqlcignhdlfmrrr

SCOPe Domain Coordinates for d4zrka3:

Click to download the PDB-style file with coordinates for d4zrka3.
(The format of our PDB-style files is described here.)

Timeline for d4zrka3: