Lineage for d4ya4q_ (4ya4 Q:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2599790Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)
  8. 2600996Domain d4ya4q_: 4ya4 Q: [274066]
    Other proteins in same PDB: d4ya4a_, d4ya4e_, d4ya4g_, d4ya4i_, d4ya4j_, d4ya4k_, d4ya4l_, d4ya4n_, d4ya4o_, d4ya4s_, d4ya4u_, d4ya4w_, d4ya4x_, d4ya4y_, d4ya4z_
    automated match to d1rypd_
    complexed with cl, mg; mutant

Details for d4ya4q_

PDB Entry: 4ya4 (more details), 2.9 Å

PDB Description: yeast 20s proteasome beta2-h114d mutant
PDB Compounds: (Q:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4ya4q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ya4q_ d.153.1.4 (Q:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d4ya4q_:

Click to download the PDB-style file with coordinates for d4ya4q_.
(The format of our PDB-style files is described here.)

Timeline for d4ya4q_: