SCOPe 2.01: Domain d1stpa_: 1stp A:

Lineage for d1stpa_ (1stp A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (118 PDB entries)

8. Domain d1stpa_: 1stp A: [27406]
   complexed with btn

Details for d1stpa_

PDB Entry: 1stp, 2.6 Å

PDB Description: structural origins of high-affinity biotin binding to streptavidin

PDB Compounds: (A:) streptavidin complex with biotin

SCOPe Domain Sequences for d1stpa_:

Sequence; same for both SEQRES and ATOM records:

>d1stpa_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
v

Timeline for d1stpa_:

• d1stpa_ first appeared (with stable ids) in SCOP 1.55, called d1stp__
  
• d1stpa_ appears in SCOP 1.75
  
• d1stpa_ appears in SCOPe 2.02
  
• d1stpa_ appears in the current release, SCOPe 2.08