Lineage for d4ya1r_ (4ya1 R:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1936395Protein automated matches [190144] (7 species)
    not a true protein
  7. 1936658Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (41 PDB entries)
  8. 1936942Domain d4ya1r_: 4ya1 R: [274046]
    Other proteins in same PDB: d4ya1a_, d4ya1e_, d4ya1g_, d4ya1i_, d4ya1j_, d4ya1k_, d4ya1l_, d4ya1n_, d4ya1o_, d4ya1s_, d4ya1u_, d4ya1w_, d4ya1x_, d4ya1y_, d4ya1z_
    automated match to d1rype_
    complexed with cl, mg; mutant

Details for d4ya1r_

PDB Entry: 4ya1 (more details), 2.9 Å

PDB Description: yeast 20s proteasome beta2-h116n mutant
PDB Compounds: (R:) Proteasome subunit alpha type-5

SCOPe Domain Sequences for d4ya1r_:

Sequence, based on SEQRES records: (download)

>d4ya1r_ d.153.1.4 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

Sequence, based on observed residues (ATOM records): (download)

>d4ya1r_ d.153.1.4 (R:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgelms
rpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlke
aellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae

SCOPe Domain Coordinates for d4ya1r_:

Click to download the PDB-style file with coordinates for d4ya1r_.
(The format of our PDB-style files is described here.)

Timeline for d4ya1r_: