Lineage for d1sldb_ (1sld B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.61: Streptavidin-like [50875] (3 superfamilies) Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) 
Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins) Protein Streptavidin [50878] (1 species) Species Streptomyces avidinii [TaxId:1895] [50879] (84 PDB entries) 
Domain d1sldb_: 1sld B: [27401]
Details for d1sldb_
PDB Entry: 1sld (more details), 2.3 Å
PDB Description: streptavidin, ph 7.5, bound to cyclic disulfide-bonded peptide ligand ac-chpqfc-nh2
SCOP Domain Sequences for d1sldb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sldb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
v
SCOP Domain Coordinates for d1sldb_:
Click to download the PDB-style file with coordinates for d1sldb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1sldb_:
- d1sldb_ appears in SCOP 1.57
- d1sldb_ appears in the current release, SCOPe 2.08
View in 3D