Lineage for d4xz0a2 (4xz0 A:133-257)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965668Protein automated matches [190202] (2 species)
    not a true protein
  7. 2965669Species Human (Homo sapiens) [TaxId:9606] [186949] (18 PDB entries)
  8. 2965686Domain d4xz0a2: 4xz0 A:133-257 [273943]
    Other proteins in same PDB: d4xz0a3
    automated match to d2oq1a2
    complexed with 4n5, so4

Details for d4xz0a2

PDB Entry: 4xz0 (more details), 2 Å

PDB Description: zap-70-tsh2:compound-a complex
PDB Compounds: (A:) tyrosine-protein kinase zap-70

SCOPe Domain Sequences for d4xz0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xz0a2 d.93.1.1 (A:133-257) automated matches {Human (Homo sapiens) [TaxId: 9606]}
legealeqaiisqapqvekliattahermpwyhssltreeaerklysgaqtdgkfllrpr
keqgtyalsliygktvyhylisqdkagkycipegtkfdtlwqlveylklkadgliyclke
acpns

SCOPe Domain Coordinates for d4xz0a2:

Click to download the PDB-style file with coordinates for d4xz0a2.
(The format of our PDB-style files is described here.)

Timeline for d4xz0a2: