Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein automated matches [190202] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186949] (18 PDB entries) |
Domain d4xz0a2: 4xz0 A:133-257 [273943] Other proteins in same PDB: d4xz0a3 automated match to d2oq1a2 complexed with 4n5, so4 |
PDB Entry: 4xz0 (more details), 2 Å
SCOPe Domain Sequences for d4xz0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xz0a2 d.93.1.1 (A:133-257) automated matches {Human (Homo sapiens) [TaxId: 9606]} legealeqaiisqapqvekliattahermpwyhssltreeaerklysgaqtdgkfllrpr keqgtyalsliygktvyhylisqdkagkycipegtkfdtlwqlveylklkadgliyclke acpns
Timeline for d4xz0a2: