SCOPe 2.01: Domain d1swdc_: 1swd C:

Lineage for d1swdc_ (1swd C:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (118 PDB entries)

8. Domain d1swdc_: 1swd C: [27385]
   complexed with btn

Details for d1swdc_

PDB Entry: 1swd, 1.9 Å

PDB Description: apo-core-streptavidin in complex with biotin (two unoccupied binding sites) at ph 4.5

PDB Compounds: (C:) streptavidin

SCOPe Domain Sequences for d1swdc_:

Sequence, based on SEQRES records:

>d1swdc_ b.61.1.1 (C:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

Sequence, based on observed residues (ATOM records):

>d1swdc_ b.61.1.1 (C:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesnaesryvltgrydsapatdgsgtalgwtva
wknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

Timeline for d1swdc_:

• d1swdc_ first appeared (with stable ids) in SCOP 1.55
  
• d1swdc_ appears in SCOP 1.75
  
• d1swdc_ appears in SCOPe 2.02
  
• d1swdc_ appears in the current release, SCOPe 2.08