Lineage for d1swdb_ (1swd B:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 170128Fold b.61: Streptavidin-like [50875] (5 superfamilies)
  4. 170129Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 170130Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 170145Protein Streptavidin [50878] (1 species)
  7. 170146Species Streptomyces avidinii [TaxId:1895] [50879] (89 PDB entries)
  8. 170313Domain d1swdb_: 1swd B: [27384]

Details for d1swdb_

PDB Entry: 1swd (more details), 1.9 Å

PDB Description: apo-core-streptavidin in complex with biotin (two unoccupied binding sites) at ph 4.5

SCOP Domain Sequences for d1swdb_:

Sequence, based on SEQRES records: (download)

>d1swdb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

Sequence, based on observed residues (ATOM records): (download)

>d1swdb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii}
gitgtwynqlgstfivtagadgaltgtyenaesryvltgrydsapatdgsgtalgwtvaw
knnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

SCOP Domain Coordinates for d1swdb_:

Click to download the PDB-style file with coordinates for d1swdb_.
(The format of our PDB-style files is described here.)

Timeline for d1swdb_: