SCOPe 2.08: Domain d4xfxa2: 4xfx A:148-221

Lineage for d4xfxa2 (4xfx A:148-221)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.0: automated matches [191629] (1 protein)
   not a true family

6. Protein automated matches [191156] (12 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 group m subtype b (isolate ny5) [TaxId:11698] [273803] (5 PDB entries)

8. Domain d4xfxa2: 4xfx A:148-221 [273812]
   Other proteins in same PDB: d4xfxa1
   automated match to d2m8pa2
   complexed with cl, iod

Details for d4xfxa2

PDB Entry: 4xfx, 2.43 Å

PDB Description: structure of the native full-length hiv-1 capsid protein

PDB Compounds: (A:) hiv-1 capsid protein

SCOPe Domain Sequences for d4xfxa2:

Sequence; same for both SEQRES and ATOM records:

>d4xfxa2 a.28.3.0 (A:148-221) automated matches {Human immunodeficiency virus type 1 group m subtype b (isolate ny5) [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
gatleemmtacqgv

Timeline for d4xfxa2:

• d4xfxa2 first appeared in SCOPe 2.05
  
• d4xfxa2 appears in SCOPe 2.07