Lineage for d3x2qu_ (3x2q U:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2327889Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2327890Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (2 families) (S)
  5. 2327891Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (2 proteins)
  6. 2327892Protein Cytochrome c oxidase subunit h [47696] (1 species)
  7. 2327893Species Cow (Bos taurus) [TaxId:9913] [47697] (29 PDB entries)
  8. 2327926Domain d3x2qu_: 3x2q U: [273781]
    Other proteins in same PDB: d3x2qa_, d3x2qb1, d3x2qb2, d3x2qc_, d3x2qd_, d3x2qe_, d3x2qf_, d3x2qg_, d3x2qi_, d3x2qj_, d3x2qk_, d3x2ql_, d3x2qm_, d3x2qn_, d3x2qo1, d3x2qo2, d3x2qp_, d3x2qq_, d3x2qr_, d3x2qs_, d3x2qt_, d3x2qv_, d3x2qw_, d3x2qx_, d3x2qy_, d3x2qz_
    automated match to d1v54h_
    complexed with cdl, chd, cu, cua, cyn, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3x2qu_

PDB Entry: 3x2q (more details), 2 Å

PDB Description: x-ray structure of cyanide-bound bovine heart cytochrome c oxidase in the fully oxidized state at 2.0 angstrom resolution
PDB Compounds: (U:) Cytochrome c oxidase subunit 6B1

SCOPe Domain Sequences for d3x2qu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3x2qu_ a.51.1.1 (U:) Cytochrome c oxidase subunit h {Cow (Bos taurus) [TaxId: 9913]}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOPe Domain Coordinates for d3x2qu_:

Click to download the PDB-style file with coordinates for d3x2qu_.
(The format of our PDB-style files is described here.)

Timeline for d3x2qu_: