Lineage for d3x2qv_ (3x2q V:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025021Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family) (S)
    automatically mapped to Pfam PF02937
  5. 3025022Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein)
  6. 3025023Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 3025024Species Cow (Bos taurus) [TaxId:9913] [81412] (57 PDB entries)
  8. 3025068Domain d3x2qv_: 3x2q V: [273777]
    Other proteins in same PDB: d3x2qa_, d3x2qb1, d3x2qb2, d3x2qc_, d3x2qd_, d3x2qe_, d3x2qf_, d3x2qg_, d3x2qh_, d3x2qj_, d3x2qk_, d3x2ql_, d3x2qm_, d3x2qn_, d3x2qo1, d3x2qo2, d3x2qp_, d3x2qq_, d3x2qr_, d3x2qs_, d3x2qt_, d3x2qu_, d3x2qw_, d3x2qx_, d3x2qy_, d3x2qz_
    automated match to d1v54i_
    complexed with cdl, chd, cu, cua, cyn, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3x2qv_

PDB Entry: 3x2q (more details), 2 Å

PDB Description: x-ray structure of cyanide-bound bovine heart cytochrome c oxidase in the fully oxidized state at 2.0 angstrom resolution
PDB Compounds: (V:) Cytochrome c oxidase subunit 6C

SCOPe Domain Sequences for d3x2qv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3x2qv_ f.23.3.1 (V:) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus) [TaxId: 9913]}
stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
eemrkagifqsak

SCOPe Domain Coordinates for d3x2qv_:

Click to download the PDB-style file with coordinates for d3x2qv_.
(The format of our PDB-style files is described here.)

Timeline for d3x2qv_: