SCOPe 2.05: Domain d3x2qo1: 3x2q O:1-90

Lineage for d3x2qo1 (3x2q O:1-90)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)

6. Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81454] (26 PDB entries)

8. Domain d3x2qo1: 3x2q O:1-90 [273775]
   Other proteins in same PDB: d3x2qa_, d3x2qb2, d3x2qc_, d3x2qd_, d3x2qe_, d3x2qf_, d3x2qg_, d3x2qh_, d3x2qi_, d3x2qj_, d3x2qk_, d3x2ql_, d3x2qm_, d3x2qn_, d3x2qo2, d3x2qp_, d3x2qq_, d3x2qr_, d3x2qs_, d3x2qt_, d3x2qu_, d3x2qv_, d3x2qw_, d3x2qx_, d3x2qy_, d3x2qz_
   automated match to d1v54b2
   complexed with cdl, chd, cu, cua, cyn, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d3x2qo1

PDB Entry: 3x2q, 2 Å

PDB Description: x-ray structure of cyanide-bound bovine heart cytochrome c oxidase in the fully oxidized state at 2.0 angstrom resolution

PDB Compounds: (O:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3x2qo1:

Sequence; same for both SEQRES and ATOM records:

>d3x2qo1 f.17.2.1 (O:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

Timeline for d3x2qo1:

• d3x2qo1 is new in SCOPe 2.05-stable
  
• d3x2qo1 appears in SCOPe 2.06
  
• d3x2qo1 appears in the current release, SCOPe 2.08