Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily) core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest |
Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families) automatically mapped to Pfam PF00510 |
Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins) function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel |
Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [81444] (57 PDB entries) |
Domain d3x2qc_: 3x2q C: [273757] Other proteins in same PDB: d3x2qa_, d3x2qb1, d3x2qb2, d3x2qd_, d3x2qe_, d3x2qf_, d3x2qg_, d3x2qh_, d3x2qi_, d3x2qj_, d3x2qk_, d3x2ql_, d3x2qm_, d3x2qn_, d3x2qo1, d3x2qo2, d3x2qq_, d3x2qr_, d3x2qs_, d3x2qt_, d3x2qu_, d3x2qv_, d3x2qw_, d3x2qx_, d3x2qy_, d3x2qz_ automated match to d1v54c_ complexed with cdl, chd, cu, cua, cyn, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn |
PDB Entry: 3x2q (more details), 2 Å
SCOPe Domain Sequences for d3x2qc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3x2qc_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]} hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw hfvdvvwlflyvsiywwgs
Timeline for d3x2qc_:
View in 3D Domains from other chains: (mouse over for more information) d3x2qa_, d3x2qb1, d3x2qb2, d3x2qd_, d3x2qe_, d3x2qf_, d3x2qg_, d3x2qh_, d3x2qi_, d3x2qj_, d3x2qk_, d3x2ql_, d3x2qm_, d3x2qn_, d3x2qo1, d3x2qo2, d3x2qp_, d3x2qq_, d3x2qr_, d3x2qs_, d3x2qt_, d3x2qu_, d3x2qv_, d3x2qw_, d3x2qx_, d3x2qy_, d3x2qz_ |