Lineage for d1swsa_ (1sws A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16669Fold b.61: Streptavidin-like [50875] (3 superfamilies)
  4. 16670Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 16671Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 16684Protein Streptavidin [50878] (1 species)
  7. 16685Species Streptomyces avidinii [TaxId:1895] [50879] (84 PDB entries)
  8. 16835Domain d1swsa_: 1sws A: [27375]

Details for d1swsa_

PDB Entry: 1sws (more details), 2 Å

PDB Description: core-streptavidin mutant d128a at ph 4.5

SCOP Domain Sequences for d1swsa_:

Sequence, based on SEQRES records: (download)

>d1swsa_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghatftk

Sequence, based on observed residues (ATOM records): (download)

>d1swsa_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii}
gitgtwynqlgstfivtagadgaltgtyegnaesryvltgrydsapatdgsgtalgwtva
wknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghatftk

SCOP Domain Coordinates for d1swsa_:

Click to download the PDB-style file with coordinates for d1swsa_.
(The format of our PDB-style files is described here.)

Timeline for d1swsa_: