Lineage for d1swjd_ (1swj D:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1133645Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 1133646Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 1133647Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 1133670Protein Streptavidin [50878] (1 species)
  7. 1133671Species Streptomyces avidinii [TaxId:1895] [50879] (120 PDB entries)
  8. 1133905Domain d1swjd_: 1swj D: [27374]
    mutant

Details for d1swjd_

PDB Entry: 1swj (more details), 2 Å

PDB Description: core-streptavidin mutant w79f at ph 4.5
PDB Compounds: (D:) core-streptavidin

SCOPe Domain Sequences for d1swjd_:

Sequence, based on SEQRES records: (download)

>d1swjd_ b.61.1.1 (D:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvafknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

Sequence, based on observed residues (ATOM records): (download)

>d1swjd_ b.61.1.1 (D:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyeaesryvltgrydsapatdgsgtalgwtvafk
nnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

SCOPe Domain Coordinates for d1swjd_:

Click to download the PDB-style file with coordinates for d1swjd_.
(The format of our PDB-style files is described here.)

Timeline for d1swjd_: