SCOPe 2.08: Domain d4uhfa1: 4uhf A:2-275

Lineage for d4uhfa1 (4uhf A:2-275)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Planctomycetes bacterium [TaxId:1331910] [273731] (5 PDB entries)

8. Domain d4uhfa1: 4uhf A:2-275 [273735]
   Other proteins in same PDB: d4uhfa2
   automated match to d3kxpe_
   complexed with bua, cad, pge; mutant

Details for d4uhfa1

PDB Entry: 4uhf, 1.08 Å

PDB Description: structural studies of a thermophilic esterase from thermogutta terrifontis (l37a mutant with butyrate bound)

PDB Compounds: (A:) esterase

SCOPe Domain Sequences for d4uhfa1:

Sequence; same for both SEQRES and ATOM records:

>d4uhfa1 c.69.1.0 (A:2-275) automated matches {Planctomycetes bacterium [TaxId: 1331910]}
aqrvkitttatpgeielafedtgtglpvllvhgfpldrtmwkaqreelcdefrvivpdlr
gfgesqvipgvatmeamaddlaglcnhlgltgkivlgglsmggyvafafarkyrdrlagl
ilcdtrarpdspeakenrrrvaervrregpgfiaeemiprlccestfrnhpeviekirqm
ilsappegvaaaalgmaerpdstdllpalscptlvlvgqfdaisppeemeamartipqsq
fvvipdaghlppmeqpervtqairewlrkvhtea

Timeline for d4uhfa1:

• d4uhfa1 first appeared in SCOPe 2.05, called d4uhfa_
  
• d4uhfa1 appears in SCOPe 2.07