SCOPe 2.05: Domain d4tq9b_: 4tq9 B:

Lineage for d4tq9b_ (4tq9 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (27 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (145 PDB entries)

8. Domain d4tq9b_: 4tq9 B: [273729]
   automated match to d4obeb_
   complexed with gdp, mg; mutant

Details for d4tq9b_

PDB Entry: 4tq9, 1.49 Å

PDB Description: crystal structure of a gdp-bound g12v oncogenic mutant of human gtpase kras

PDB Compounds: (B:) GTPase KRas

SCOPe Domain Sequences for d4tq9b_:

Sequence; same for both SEQRES and ATOM records:

>d4tq9b_ c.37.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gmteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
gqeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcd
lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke

Timeline for d4tq9b_:

• d4tq9b_ is new in SCOPe 2.05-stable
  
• d4tq9b_ is called d4tq9b1 in SCOPe 2.06
  
• d4tq9b_ appears in the current release, SCOPe 2.08, called d4tq9b1