Lineage for d4rzqa3 (4rzq A:331-446)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1808932Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 1809035Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 1809160Family b.84.2.0: automated matches [254217] (1 protein)
    not a true family
  6. 1809161Protein automated matches [254496] (11 species)
    not a true protein
  7. 1809187Species Haemophilus influenzae [TaxId:71421] [268355] (8 PDB entries)
  8. 1809195Domain d4rzqa3: 4rzq A:331-446 [273721]
    Other proteins in same PDB: d4rzqa1, d4rzqa2
    automated match to d2w6za3
    complexed with adp, y7y

Details for d4rzqa3

PDB Entry: 4rzq (more details), 1.98 Å

PDB Description: structural analysis of substrate, reaction intermediate and product binding in haemophilus influenzae biotin carboxylase
PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d4rzqa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rzqa3 b.84.2.0 (A:331-446) automated matches {Haemophilus influenzae [TaxId: 71421]}
kghamecrinaedpktflpspgkvnhlhspgglgvrwdshvyggytvpphydsmiaklit
ygdtrevairrmqnalsetiidgiktniplheliledenfqkggtnihylekklgm

SCOPe Domain Coordinates for d4rzqa3:

Click to download the PDB-style file with coordinates for d4rzqa3.
(The format of our PDB-style files is described here.)

Timeline for d4rzqa3: