Lineage for d4rzqa2 (4rzq A:115-330)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2541368Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2541369Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2541793Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2541794Protein automated matches [226904] (37 species)
    not a true protein
  7. 2541866Species Haemophilus influenzae [TaxId:71421] [268353] (8 PDB entries)
  8. 2541873Domain d4rzqa2: 4rzq A:115-330 [273720]
    Other proteins in same PDB: d4rzqa1, d4rzqa3, d4rzqa4
    automated match to d1dv2a3
    complexed with adp, y7y

Details for d4rzqa2

PDB Entry: 4rzq (more details), 1.98 Å

PDB Description: structural analysis of substrate, reaction intermediate and product binding in haemophilus influenzae biotin carboxylase
PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d4rzqa2:

Sequence, based on SEQRES records: (download)

>d4rzqa2 d.142.1.0 (A:115-330) automated matches {Haemophilus influenzae [TaxId: 71421]}
dkvsaikamkkagvpcvpgsdgpvsndiaknkeiakrigypiiikasgggggrgmrvvrs
edaleesiamtkaeakaafnndmvymekylenprhveiqvladthgnavylaerdcsmqr
rhqkvveeapapgiteevrrdigsrcanacveigyrgagtfeflyengefyfiemntriq
vehpvtemitgvdlvkeqlriaaglpisfkqedikv

Sequence, based on observed residues (ATOM records): (download)

>d4rzqa2 d.142.1.0 (A:115-330) automated matches {Haemophilus influenzae [TaxId: 71421]}
dkvsaikamkkagvpcvpgsdgpaknkeiakrigypiiikrvvrsedaleesiamtkaey
mekylenprhveiqvladthgnavylaerdcsmqrrhqkvveeapapgiteevrrdigsr
canacveigyrgagtfeflyengefyfiemntriqvehpvtemitgvdlvkeqlriaagl
pisfkqedikv

SCOPe Domain Coordinates for d4rzqa2:

Click to download the PDB-style file with coordinates for d4rzqa2.
(The format of our PDB-style files is described here.)

Timeline for d4rzqa2: