Lineage for d4qzea2 (4qze A:243-302)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001088Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2001966Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2002227Family a.60.12.0: automated matches [254215] (1 protein)
    not a true family
  6. 2002228Protein automated matches [254483] (3 species)
    not a true protein
  7. 2002235Species Mouse (Mus musculus) [TaxId:10090] [255237] (29 PDB entries)
  8. 2002256Domain d4qzea2: 4qze A:243-302 [273714]
    Other proteins in same PDB: d4qzea1, d4qzea3
    automated match to d1jmsa3
    protein/DNA complex; complexed with dct, mg, na; mutant

Details for d4qzea2

PDB Entry: 4qze (more details), 2.25 Å

PDB Description: mouse tdt, f401a mutant, in complex with a dsb substrate, c-g base pair
PDB Compounds: (A:) DNA nucleotidylexotransferase

SCOPe Domain Sequences for d4qzea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qzea2 a.60.12.0 (A:243-302) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
deryksfklftsvfgvglktaekwfrmgfrtlskiqsdkslrftqmqkagflyyedlvsc

SCOPe Domain Coordinates for d4qzea2:

Click to download the PDB-style file with coordinates for d4qzea2.
(The format of our PDB-style files is described here.)

Timeline for d4qzea2: