Lineage for d4qzda2 (4qzd A:243-302)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328564Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2329531Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2329809Family a.60.12.0: automated matches [254215] (1 protein)
    not a true family
  6. 2329810Protein automated matches [254483] (3 species)
    not a true protein
  7. 2329829Species Mouse (Mus musculus) [TaxId:10090] [255237] (31 PDB entries)
  8. 2329856Domain d4qzda2: 4qzd A:243-302 [273702]
    Other proteins in same PDB: d4qzda1, d4qzda3
    automated match to d1jmsa3
    protein/DNA complex; complexed with dct, mg, na; mutant

Details for d4qzda2

PDB Entry: 4qzd (more details), 2.7 Å

PDB Description: mouse tdt, f405a mutant, in complex with a dsb substrate, c-c base pair
PDB Compounds: (A:) DNA nucleotidylexotransferase

SCOPe Domain Sequences for d4qzda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qzda2 a.60.12.0 (A:243-302) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
deryksfklftsvfgvglktaekwfrmgfrtlskiqsdkslrftqmqkagflyyedlvsc

SCOPe Domain Coordinates for d4qzda2:

Click to download the PDB-style file with coordinates for d4qzda2.
(The format of our PDB-style files is described here.)

Timeline for d4qzda2: