SCOPe 2.06: Domain d4qzca1: 4qzc A:146-242

Lineage for d4qzca1 (4qzc A:146-242)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.0: automated matches [254214] (1 protein)
   not a true family

6. Protein automated matches [254482] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255236] (29 PDB entries)

8. Domain d4qzca1: 4qzc A:146-242 [273698]
   Other proteins in same PDB: d4qzca2, d4qzca3
   automated match to d1jmsa1
   protein/DNA complex; complexed with dct, mg, na; mutant

Details for d4qzca1

PDB Entry: 4qzc, 2.75 Å

PDB Description: mouse tdt, f405a mutant, in complex with a dsb substrate, c-g base pair

PDB Compounds: (A:) DNA nucleotidylexotransferase

SCOPe Domain Sequences for d4qzca1:

Sequence; same for both SEQRES and ATOM records:

>d4qzca1 a.60.6.0 (A:146-242) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avkkisqyacqrrttlnnynqlftdaldilaendelrenegsclafmrassvlkslpfpi
tsmkdtegipclgdkvksiiegiiedgesseakavln

Timeline for d4qzca1:

• d4qzca1 first appeared in SCOPe 2.05
  
• d4qzca1 appears in SCOPe 2.07
  
• d4qzca1 appears in the current release, SCOPe 2.08