Class a: All alpha proteins [46456] (289 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) contains one classic and one pseudo HhH motifs |
Family a.60.12.0: automated matches [254215] (1 protein) not a true family |
Protein automated matches [254483] (3 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [255237] (29 PDB entries) |
Domain d4qzba2: 4qzb A:243-302 [273696] Other proteins in same PDB: d4qzba1, d4qzba3 automated match to d1jmsa3 protein/DNA complex; complexed with dct, mg, na |
PDB Entry: 4qzb (more details), 2.15 Å
SCOPe Domain Sequences for d4qzba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qzba2 a.60.12.0 (A:243-302) automated matches {Mouse (Mus musculus) [TaxId: 10090]} deryksfklftsvfgvglktaekwfrmgfrtlskiqsdkslrftqmqkagflyyedlvsc
Timeline for d4qzba2: