Lineage for d4qkql_ (4qkq L:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1847928Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 1848148Protein DNA repair protein Rad51, catalytic domain [82412] (7 species)
  7. 1848159Species Methanococcus voltae [TaxId:2188] [110555] (11 PDB entries)
    Uniprot O73948
  8. 1848179Domain d4qkql_: 4qkq L: [273668]
    automated match to d4dc9a_
    protein/DNA complex; complexed with 35n, no3

Details for d4qkql_

PDB Entry: 4qkq (more details), 2 Å

PDB Description: rada from methanococcus voltae in complex with copper phthalocyanine tetrasulfonate inhibitor
PDB Compounds: (L:) DNA repair and recombination protein radA

SCOPe Domain Sequences for d4qkql_:

Sequence, based on SEQRES records: (download)

>d4qkql_ c.37.1.11 (L:) DNA repair protein Rad51, catalytic domain {Methanococcus voltae [TaxId: 2188]}
shmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhq
scvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldnt
fvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrh
matlnkladlfncvvlvtnqvsakpdaffgmaeqaigghivghaatfrffvrkgkgdkrv
aklydsphlpdaeaifritekgiqd

Sequence, based on observed residues (ATOM records): (download)

>d4qkql_ c.37.1.11 (L:) DNA repair protein Rad51, catalytic domain {Methanococcus voltae [TaxId: 2188]}
shmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhq
scvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldnt
fvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrh
matlnkladlfncvvlvtnqvsaaeqaigghivghaatfrffvrkgkgdkrvaklydsph
lpdaeaifritekgiqd

SCOPe Domain Coordinates for d4qkql_:

Click to download the PDB-style file with coordinates for d4qkql_.
(The format of our PDB-style files is described here.)

Timeline for d4qkql_: