SCOPe 2.05: Domain d5a16f1: 5a16 F:1-111

Lineage for d5a16f1 (5a16 F:1-111)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [272437] (43 PDB entries)

8. Domain d5a16f1: 5a16 F:1-111 [273621]
   Other proteins in same PDB: d5a16b2, d5a16d2, d5a16f2, d5a16h2
   automated match to d1a5fl1

Details for d5a16f1

PDB Entry: 5a16, 2.5 Å

PDB Description: crystal structure of fab4201 raised against human erythrocyte anion exchanger 1

PDB Compounds: (F:) fab4201 heavy chain

SCOPe Domain Sequences for d5a16f1:

Sequence; same for both SEQRES and ATOM records:

>d5a16f1 b.1.1.0 (F:1-111) automated matches {Mus musculus [TaxId: 10090]}
divmtqspaslavslgqratiscrasqsvstssysymnwyqqkpgqppkllikyasnles
gvparfsgsgsgtdftlnihpleeedtatyycqhsweipwtfgggtkveik

Timeline for d5a16f1:

• d5a16f1 is new in SCOPe 2.05-stable
  
• d5a16f1 appears in SCOPe 2.06
  
• d5a16f1 appears in the current release, SCOPe 2.08