![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (14 species) not a true protein |
![]() | Species Mus musculus [TaxId:10090] [272441] (35 PDB entries) |
![]() | Domain d5a16b2: 5a16 B:112-218 [273611] Other proteins in same PDB: d5a16b1, d5a16d1, d5a16f1, d5a16h1 automated match to d1tqbc2 |
PDB Entry: 5a16 (more details), 2.5 Å
SCOPe Domain Sequences for d5a16b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a16b2 b.1.1.2 (B:112-218) automated matches {Mus musculus [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d5a16b2: